PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015799-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 493aa    MW: 55492.4 Da    PI: 6.8704
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015799-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.42.5e-32229286260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDgynWrKYGqK+vkgse+prsYY+Ct+++C+vkk++ers+ d++++ei+Y+g+H+h+k
  NNU_015799-RA 229 DDGYNWRKYGQKHVKGSEYPRSYYKCTHPNCQVKKQLERSH-DGQITEIIYKGSHDHPK 286
                    8****************************************.***************85 PP

2WRKY35.91.5e-11405426122
                    ---SS-EEEEEEE--TT-SS-E CS
           WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                    ldDgy+WrKYGqK+vkg+++pr
  NNU_015799-RA 405 LDDGYRWRKYGQKVVKGNPNPR 426
                    59*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-28221287IPR003657WRKY domain
PROSITE profilePS5081124.26223287IPR003657WRKY domain
SuperFamilySSF1182907.06E-26224287IPR003657WRKY domain
SMARTSM007742.8E-35228286IPR003657WRKY domain
PfamPF031061.4E-24229285IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-14390427IPR003657WRKY domain
SuperFamilySSF1182901.19E-9397427IPR003657WRKY domain
PROSITE profilePS5081115.686400426IPR003657WRKY domain
SMARTSM007741.3E-4405451IPR003657WRKY domain
PfamPF031063.4E-7406427IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MHDRDGSAKF SSATDAPKNA YDEKDCRYCL QQMVFSSSYV KLSRPDEALD NGCQDVAEAI  60
DLAKVGNFTF TVKLFTVKCS RMQLGGNNIA FLLNLIFFLL VPQKLLLLYL NFCMFLCMPN  120
SVFALKASTG LNYKQPDPLV QLQGQYQSHS FAVSSSAKSE NSAASSHELT LSVTAPDPPV  180
QLVTPGDGVP PEISSDELQQ RQGSNSGFQP SQSDQKGSNP SIVAEKTADD GYNWRKYGQK  240
HVKGSEYPRS YYKCTHPNCQ VKKQLERSHD GQITEIIYKG SHDHPKPQPS RRLAAGTILS  300
IQEEKSDRFS SLTNLEDKLS NVHGQTTHHI EPNGTPELSP VTASDDDIEG VVGYSNRIGD  360
DVNDDEDPES KRRKKEIDCV DVTPMGKPIR EPRVVVQTLS EVDILDDGYR WRKYGQKVVK  420
GNPNPRYSSY LSDILGRKDL PDKSDRLTCS HFYSLYDLPI YLMKFRKPFL FFSFFSHSRD  480
WFLKLQPLAM HID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A5e-182282871474WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270167.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ6VWJ66e-90WRK46_HORVU; WRKY transcription factor SUSIBA2
TrEMBLF6HER41e-119F6HER4_VITVI; Putative uncharacterized protein
STRINGVIT_19s0090g01720.t011e-118(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.17e-89WRKY family protein